PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy015174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 639aa    MW: 72462 Da    PI: 5.2024
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59511629PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS350.13.5e-1072726363373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL++cA+av++ d+++a  +L+++++++sp+gd mqR+a+yf+ +L++rl+    ++ + lp   +s    ++ l+a+kl++ +sP+ ++++  a q+I
  Ahy015174 272 SLLTRCAQAVANYDQRNAYDTLKQIRQHSSPAGDGMQRMAHYFAIGLETRLNA---GTPSYLPLDMAS---AADMLKAHKLYVTASPLQRMTNTFATQTI 365
                79**************************************************9...455555666665...899************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                ++ v++e++vHiiDf+i +G+QWp+L++ L++R + p +lRiTg++ p++g   +e+leetg+rL++++++ +vpfe+n  +a+++e+++le+L+++++E
  Ahy015174 366 MNLVQNESCVHIIDFGICYGFQWPCLIKRLSQR-NAPIKLRITGIDLPQPGfrPAERLEETGRRLENYCKRHNVPFEYNC-IAQKWETIRLEDLKIDRNE 463
                ********************************9.5668************9*****************************.7****************** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                +++Vn+ ++l++l+de+v ++s+rd+vLkl++s++P+++ +   + +++++ Fl+rf eal ++s+ fd++ea++pre+ er+ +E+ l+gr++ nv+ac
  Ahy015174 464 VTVVNCFYRLKNLPDETVLVNSPRDAVLKLIRSINPNIFLHGVVNGSYSAPFFLTRFREALFHFSSQFDMFEANVPREDVERMILEKGLIGRDAINVIAC 563
                **************************************************************************************************** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                egaer+er et+++W+ r ++aGFk+++++++ ++++k +++k + + + v+++ +++++gWk+r L ++SaW
  Ahy015174 564 EGAERVERPETYKQWQIRNKRAGFKQIRVDQELVNEIKGMVKKEYHRDFVVDQDGKWVLQGWKGRILHALSAW 636
                *********************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.674244617IPR005202Transcription factor GRAS
PfamPF035141.2E-104272636IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MNGFHYEGSS YSPGTSSSED SAEYNKYSNP ILRYISDILM EEEDDLENKP CMLQQCLKLQ  60
AAEKSFSEVL GNSSNSIPSQ GCDENNRDGD YGRTTSFESY SSCTTDNNSY ESDWVNLVGE  120
YESSLLQAPD NDSYESDWLN LLDSPNDGSS EIHYQNMVLL TNNEEGSRSG TTGTREKRSI  180
QVDDDTSYEQ GRRGSKISAV FSDESEPPEI LDEVLRVQIG RSQCLSGVEP LPENEMLKRQ  240
NVDSVGSSGK TARSKKGSSR NSNTGATVDL WSLLTRCAQA VANYDQRNAY DTLKQIRQHS  300
SPAGDGMQRM AHYFAIGLET RLNAGTPSYL PLDMASAADM LKAHKLYVTA SPLQRMTNTF  360
ATQTIMNLVQ NESCVHIIDF GICYGFQWPC LIKRLSQRNA PIKLRITGID LPQPGFRPAE  420
RLEETGRRLE NYCKRHNVPF EYNCIAQKWE TIRLEDLKID RNEVTVVNCF YRLKNLPDET  480
VLVNSPRDAV LKLIRSINPN IFLHGVVNGS YSAPFFLTRF REALFHFSSQ FDMFEANVPR  540
EDVERMILEK GLIGRDAINV IACEGAERVE RPETYKQWQI RNKRAGFKQI RVDQELVNEI  600
KGMVKKEYHR DFVVDQDGKW VLQGWKGRIL HALSAWVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-362706365374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935607.10.0PREDICTED: scarecrow-like protein 9
SwissprotQ9XE581e-164SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0L9UNH10.0A0A0L9UNH1_PHAAN; Uncharacterized protein
STRINGGLYMA15G04160.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-165SCARECROW-like 14